• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SMAD Antibody [SMAD1-5]

SMAD Antibody [SMAD1-5] (R32238)

  Catalog No Formulation Size Price (USD)  
Image R32238 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat heart, 2) mouse heart, 3) rat skeletal muscle, 4) mouse skeletal muscle, 5) 293, 6) MCF7 and 7) HeLa lysate with SMAD antibody. Expected molecular weight of SMADs 1-5: 48~60 kDa, observed here at ~52 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Predicted Reactivity Hamster
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q15797
Localization Nuclear and cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
Limitations This SMAD antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.

Application Notes

Optimal dilution of the SMAD antibody should be determined by the researcher.

Immunogen

Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.

Storage

After reconstitution, the SMAD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.